PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678448001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family TALE
Protein Properties Length: 539aa    MW: 58413.4 Da    PI: 8.4582
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678448001genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.18.5e-104044411954
                HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
   Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                Fe   ++yps +++  LA+++gL+++qV++WF N R +
  678448001 404 FEHflHPYPSDADKHLLARQTGLSKNQVSNWFINARVR 441
                664459******************************88 PP

2BELL110.97.5e-36266336272
       BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                r e++++k+kL s+l+eV++rY +y+eq+q+v++sF++v+g+ +a+pYtslA++a+SrhFr+Lkdaia+q+
  678448001 266 RLEHHRRKVKLTSMLDEVERRYGRYCEQMQAVVNSFDMVMGCKAAAPYTSLAQRAMSRHFRSLKDAIAGQL 336
                779*****************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005747.1E-53207334IPR006563POX domain
PfamPF075266.9E-44212333IPR006563POX domain
PROSITE profilePS5007112.633382445IPR001356Homeobox domain
CDDcd000869.94E-13385446No hitNo description
SMARTSM003898.0E-10385449IPR001356Homeobox domain
SuperFamilySSF466892.31E-17387452IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-28388451IPR009057Homeodomain-like
PfamPF059203.6E-18402441IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009965Biological Processleaf morphogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 539 aa     Download sequence    Send to blast
MSRNYNQGVY GFDPPSAGRQ AQLVGMEEGG GGMPVYGTGG GGMFPEMFSF QPTTATELLE  60
NQILQSYGNP RVPATDWLSH QQPMVVGGSG RGGLGNSGVD SAMHLFLMNP HQQKSPSPSP  120
SSPPPPPPPP SDVFSQFPWL SSAAAAAGAG VTAETQGLSL SLSSNKAEEL FYVSGGGPYQ  180
FKNLIADGAG ALQSHHHAAS SSSSSSYGAL NMLRNSRYAK AAQELLEELC TVGKKTKSRQ  240
NNNIRSASAD AAFPKDTPPT CSAADRLEHH RRKVKLTSML DEVERRYGRY CEQMQAVVNS  300
FDMVMGCKAA APYTSLAQRA MSRHFRSLKD AIAGQLKHSC EMLGEKETRI SSITKGETPR  360
LKILEQSLRQ QRAFHQMGMM EQEAWRPQRG LPERSVSILR AWLFEHFLHP YPSDADKHLL  420
ARQTGLSKNQ VSNWFINARV RLWKPMVEQM YQQEAKDEEG DREENSGGSG ATPMTVSAST  480
PSQTNTSDNR EPPATPTNAD IESTMKRFGI SSGGDVSLTL GLRHAGGAPG STNFPHAGH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A1e-16391449563Homeobox protein Meis2
3k2a_B1e-16391449563Homeobox protein Meis2
5bng_A9e-17391449159Homeobox protein Meis2
5bng_B9e-17391449159Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011099269.11e-171PREDICTED: BEL1-like homeodomain protein 4
SwissprotQ9SW801e-125BLH2_ARATH; BEL1-like homeodomain protein 2
TrEMBLA0A022RUY31e-161A0A022RUY3_ERYGU; Uncharacterized protein
STRINGPGSC0003DMT4000261721e-156(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA33412139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23760.31e-123BEL1-like homeodomain 4